SCOPe 2.08: Domain d1vp8a1: 1vp8 A:1-189

Lineage for d1vp8a1 (1vp8 A:1-189)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families)

5. Family c.49.1.2: MTH1675-like [110616] (2 proteins)
   PfamB PB019040; probable flavoenzyme, binds FMN; the phosphoribityl group binds in the equivalent site to the binding site of the PK allosteric regulator FBP

6. Protein Hypothetical protein AF0103 [117613] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [117614] (1 PDB entry)
   Uniprot O30133

8. Domain d1vp8a1: 1vp8 A:1-189 [113947]
   Other proteins in same PDB: d1vp8a2
   Structural genomics target
   complexed with fmn, unl

Details for d1vp8a1

PDB Entry: 1vp8, 1.3 Å

PDB Description: crystal structure of an alpha/beta domain of a putative pyruvate kinase (af0103) from archaeoglobus fulgidus dsm 4304 at 1.30 a resolution

PDB Compounds: (A:) hypothetical protein AF0103

SCOPe Domain Sequences for d1vp8a1:

Sequence; same for both SEQRES and ATOM records:

>d1vp8a1 c.49.1.2 (A:1-189) Hypothetical protein AF0103 {Archaeoglobus fulgidus [TaxId: 2234]}
mekkivyfnkpgrenteetlrlaverakelgikhlvvassygdtamkalemaeglevvvv
tyhtgfvregentmppeveeelrkrgakivrqshilsglersisrklggvsrteaiaeal
rslfghglkvcveitimaadsgaipieevvavggrsrgadtavvirpahmnnffdaeike
iicmprnkr

Timeline for d1vp8a1:

• d1vp8a1 first appeared in SCOP 1.71, called d1vp8a_
  
• d1vp8a1 appears in SCOPe 2.07