Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) |
Family c.49.1.2: MTH1675-like [110616] (2 proteins) PfamB PB019040; probable flavoenzyme, binds FMN; the phosphoribityl group binds in the equivalent site to the binding site of the PK allosteric regulator FBP |
Protein Hypothetical protein AF0103 [117613] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [117614] (1 PDB entry) Uniprot O30133 |
Domain d1vp8a1: 1vp8 A:1-189 [113947] Other proteins in same PDB: d1vp8a2 Structural genomics target complexed with fmn, unl |
PDB Entry: 1vp8 (more details), 1.3 Å
SCOPe Domain Sequences for d1vp8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vp8a1 c.49.1.2 (A:1-189) Hypothetical protein AF0103 {Archaeoglobus fulgidus [TaxId: 2234]} mekkivyfnkpgrenteetlrlaverakelgikhlvvassygdtamkalemaeglevvvv tyhtgfvregentmppeveeelrkrgakivrqshilsglersisrklggvsrteaiaeal rslfghglkvcveitimaadsgaipieevvavggrsrgadtavvirpahmnnffdaeike iicmprnkr
Timeline for d1vp8a1: