Lineage for d1vp7f_ (1vp7 F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985195Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985557Superfamily a.7.13: XseB-like [116842] (1 family) (S)
    helix-swapped homodimer
  5. 1985558Family a.7.13.1: XseB-like [116843] (1 protein)
    Pfam PF02609
  6. 1985559Protein Exonuclease VII small subunit XseB [116844] (1 species)
  7. 1985560Species Bordetella pertussis [TaxId:520] [116845] (1 PDB entry)
    Uniprot Q7VV85 13-80
  8. 1985566Domain d1vp7f_: 1vp7 F: [113946]
    Structural genomics target

Details for d1vp7f_

PDB Entry: 1vp7 (more details), 2.4 Å

PDB Description: Crystal structure of Exodeoxyribonuclease VII small subunit (NP_881400.1) from Bordetella pertussis at 2.40 A resolution
PDB Compounds: (F:) exodeoxyribonuclease VII small subunit

SCOPe Domain Sequences for d1vp7f_:

Sequence, based on SEQRES records: (download)

>d1vp7f_ a.7.13.1 (F:) Exonuclease VII small subunit XseB {Bordetella pertussis [TaxId: 520]}
arplpqdfetalaeleslvsamengtlpleqslsayrrgvelarvcqdrlaqaeqqvkvl
egdllrp

Sequence, based on observed residues (ATOM records): (download)

>d1vp7f_ a.7.13.1 (F:) Exonuclease VII small subunit XseB {Bordetella pertussis [TaxId: 520]}
arplpqdfetalaeleslvsamenlpleqslsayrrgvelarvcqdrlaqaeqqvkvleg
dllrp

SCOPe Domain Coordinates for d1vp7f_:

Click to download the PDB-style file with coordinates for d1vp7f_.
(The format of our PDB-style files is described here.)

Timeline for d1vp7f_: