Lineage for d1vp7c_ (1vp7 C:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534473Fold a.7: Spectrin repeat-like [46965] (13 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 534667Superfamily a.7.13: XseB-like [116842] (1 family) (S)
    helix-swapped homodimer
  5. 534668Family a.7.13.1: XseB-like [116843] (1 protein)
    Pfam 02609
  6. 534669Protein Exonuclease VII small subunit XseB [116844] (1 species)
  7. 534670Species Bordetella pertussis [TaxID:520] [TaxId:520] [116845] (1 PDB entry)
  8. 534673Domain d1vp7c_: 1vp7 C: [113943]

Details for d1vp7c_

PDB Entry: 1vp7 (more details), 2.4 Å

PDB Description: crystal structure of exodeoxyribonuclease vii small subunit (np_881400.1) from bordetella pertussis at 2.40 a resolution

SCOP Domain Sequences for d1vp7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vp7c_ a.7.13.1 (C:) Exonuclease VII small subunit XseB {Bordetella pertussis [TaxID:520]}
pqtdarplpqdfetalaeleslvsamengtlpleqslsayrrgvelarvcqdrlaqaeqq
vkvlegdllrp

SCOP Domain Coordinates for d1vp7c_:

Click to download the PDB-style file with coordinates for d1vp7c_.
(The format of our PDB-style files is described here.)

Timeline for d1vp7c_: