Lineage for d1vp7c_ (1vp7 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696882Superfamily a.7.13: XseB-like [116842] (1 family) (S)
    helix-swapped homodimer
  5. 2696883Family a.7.13.1: XseB-like [116843] (1 protein)
    Pfam PF02609
  6. 2696884Protein Exonuclease VII small subunit XseB [116844] (1 species)
  7. 2696885Species Bordetella pertussis [TaxId:520] [116845] (1 PDB entry)
    Uniprot Q7VV85 13-80
  8. 2696888Domain d1vp7c_: 1vp7 C: [113943]
    Structural genomics target

Details for d1vp7c_

PDB Entry: 1vp7 (more details), 2.4 Å

PDB Description: crystal structure of exodeoxyribonuclease vii small subunit (np_881400.1) from bordetella pertussis at 2.40 a resolution
PDB Compounds: (C:) exodeoxyribonuclease VII small subunit

SCOPe Domain Sequences for d1vp7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vp7c_ a.7.13.1 (C:) Exonuclease VII small subunit XseB {Bordetella pertussis [TaxId: 520]}
pqtdarplpqdfetalaeleslvsamengtlpleqslsayrrgvelarvcqdrlaqaeqq
vkvlegdllrp

SCOPe Domain Coordinates for d1vp7c_:

Click to download the PDB-style file with coordinates for d1vp7c_.
(The format of our PDB-style files is described here.)

Timeline for d1vp7c_: