| Class b: All beta proteins [48724] (177 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
| Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
| Protein Putative ion channel CnbD [110321] (1 species) |
| Species Mesorhizobium loti [TaxId:381] [110322] (3 PDB entries) Uniprot Q98GN8 218-350 # mll3241 |
| Domain d1vp6c_: 1vp6 C: [113940] complexed with br, cmp |
PDB Entry: 1vp6 (more details), 1.7 Å
SCOPe Domain Sequences for d1vp6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vp6c_ b.82.3.2 (C:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]}
vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
aeifrktalerrg
Timeline for d1vp6c_: