SCOPe 2.05: Domain d1vp6c_: 1vp6 C:

Lineage for d1vp6c_ (1vp6 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Putative ion channel CnbD [110321] (1 species)

7. Species Mesorhizobium loti [TaxId:381] [110322] (2 PDB entries)
   Uniprot Q98GN8 218-350 # mll3241

8. Domain d1vp6c_: 1vp6 C: [113940]
   complexed with br, cmp

Details for d1vp6c_

PDB Entry: 1vp6, 1.7 Å

PDB Description: M.loti ion channel cylic nucleotide binding domain

PDB Compounds: (C:) Cyclic-nucleotide binding domain of mesorhizobium loti CNG potassium channel

SCOPe Domain Sequences for d1vp6c_:

Sequence; same for both SEQRES and ATOM records:

>d1vp6c_ b.82.3.2 (C:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]}
vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
aeifrktalerrg

Timeline for d1vp6c_:

• d1vp6c_ first appeared in SCOP 1.71
  
• d1vp6c_ appears in SCOPe 2.04
  
• d1vp6c_ appears in SCOPe 2.06
  
• d1vp6c_ appears in the current release, SCOPe 2.08