Lineage for d1vp6c_ (1vp6 C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 567256Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 567656Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 567662Family b.82.3.2: cAMP-binding domain [51210] (7 proteins)
    Pfam 00027
  6. 567701Protein Putative ion channel CnbD [110321] (1 species)
  7. 567702Species Mesorhizobium loti [TaxId:381] [110322] (2 PDB entries)
  8. 567704Domain d1vp6c_: 1vp6 C: [113940]
    complexed with br, cmp

Details for d1vp6c_

PDB Entry: 1vp6 (more details), 1.7 Å

PDB Description: M.loti ion channel cylic nucleotide binding domain

SCOP Domain Sequences for d1vp6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vp6c_ b.82.3.2 (C:) Putative ion channel CnbD {Mesorhizobium loti}
vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
aeifrktalerrg

SCOP Domain Coordinates for d1vp6c_:

Click to download the PDB-style file with coordinates for d1vp6c_.
(The format of our PDB-style files is described here.)

Timeline for d1vp6c_: