Class b: All beta proteins [48724] (149 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) |
Family b.82.3.2: cAMP-binding domain [51210] (7 proteins) Pfam 00027 |
Protein Putative ion channel CnbD [110321] (1 species) |
Species Mesorhizobium loti [TaxId:381] [110322] (2 PDB entries) |
Domain d1vp6a_: 1vp6 A: [113939] |
PDB Entry: 1vp6 (more details), 1.7 Å
SCOP Domain Sequences for d1vp6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti} vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei aeifrktalerrg
Timeline for d1vp6a_: