SCOP 1.71: Domain d1vp6a_: 1vp6 A:

Lineage for d1vp6a_ (1vp6 A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (7 proteins)
   Pfam 00027

6. Protein Putative ion channel CnbD [110321] (1 species)

7. Species Mesorhizobium loti [TaxId:381] [110322] (2 PDB entries)

8. Domain d1vp6a_: 1vp6 A: [113939]

Details for d1vp6a_

PDB Entry: 1vp6, 1.7 Å

PDB Description: M.loti ion channel cylic nucleotide binding domain

SCOP Domain Sequences for d1vp6a_:

Sequence; same for both SEQRES and ATOM records:

>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti}
vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
aeifrktalerrg

Timeline for d1vp6a_:

• d1vp6a_ is new in SCOP 1.71
  
• d1vp6a_ appears in SCOP 1.73
  
• d1vp6a_ appears in the current release, SCOPe 2.08