Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein 2,5-diketo-D-gluconic acid reductase A [51443] (3 species) |
Species Thermotoga maritima [TaxId:2336] [117365] (1 PDB entry) Uniprot Q9X0A2 |
Domain d1vp5b_: 1vp5 B: [113938] Structural genomics target complexed with nap |
PDB Entry: 1vp5 (more details), 2.4 Å
SCOPe Domain Sequences for d1vp5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vp5b_ c.1.7.1 (B:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} qvpkvtlnngvempilgygvfqippekteecvyeaikvgyrlidtaasymneegvgraik raidegivrreelfvttklwvsdvgyestkkafekslkklqleyidlylihqpfgdvhca wkameemykdglvraigvsnfypdrlmdlmvhheivpavnqieihpfyqrqeeiefmrny niqpeawgpfaegrknifqngvlrsiaekygktvaqvilrwltqkgivaipktvrrermk enisifdfeltqedmekiatldegqsaffshrdpevvkwicsl
Timeline for d1vp5b_: