Lineage for d1vp5b_ (1vp5 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2092401Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2092402Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2092403Protein 2,5-diketo-D-gluconic acid reductase A [51443] (3 species)
  7. 2092411Species Thermotoga maritima [TaxId:2336] [117365] (1 PDB entry)
    Uniprot Q9X0A2
  8. 2092413Domain d1vp5b_: 1vp5 B: [113938]
    Structural genomics target
    complexed with nap

Details for d1vp5b_

PDB Entry: 1vp5 (more details), 2.4 Å

PDB Description: crystal structure of 2,5-diketo-d-gluconic acid reductase (tm1009) from thermotoga maritima at 2.40 a resolution
PDB Compounds: (B:) 2,5-diketo-d-gluconic acid reductase

SCOPe Domain Sequences for d1vp5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vp5b_ c.1.7.1 (B:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]}
qvpkvtlnngvempilgygvfqippekteecvyeaikvgyrlidtaasymneegvgraik
raidegivrreelfvttklwvsdvgyestkkafekslkklqleyidlylihqpfgdvhca
wkameemykdglvraigvsnfypdrlmdlmvhheivpavnqieihpfyqrqeeiefmrny
niqpeawgpfaegrknifqngvlrsiaekygktvaqvilrwltqkgivaipktvrrermk
enisifdfeltqedmekiatldegqsaffshrdpevvkwicsl

SCOPe Domain Coordinates for d1vp5b_:

Click to download the PDB-style file with coordinates for d1vp5b_.
(The format of our PDB-style files is described here.)

Timeline for d1vp5b_: