Lineage for d1vp5a_ (1vp5 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570948Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 570949Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
    Common fold covers whole protein structure
  6. 570950Protein 2,5-diketo-D-gluconic acid reductase A [51443] (3 species)
  7. 570958Species Thermotoga maritima [TaxId:243274] [117365] (1 PDB entry)
  8. 570959Domain d1vp5a_: 1vp5 A: [113937]

Details for d1vp5a_

PDB Entry: 1vp5 (more details), 2.4 Å

PDB Description: crystal structure of 2,5-diketo-d-gluconic acid reductase (tm1009) from thermotoga maritima at 2.40 a resolution

SCOP Domain Sequences for d1vp5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima}
qvpkvtlnngvempilgygvfqippekteecvyeaikvgyrlidtaasymneegvgraik
raidegivrreelfvttklwvsdvgyestkkafekslkklqleyidlylihqpfgdvhca
wkameemykdglvraigvsnfypdrlmdlmvhheivpavnqieihpfyqrqeeiefmrny
niqpeawgpfaegrknifqngvlrsiaekygktvaqvilrwltqkgivaipktvrrermk
enisifdfeltqedmekiatldegqsaffshrdpevvkwicslk

SCOP Domain Coordinates for d1vp5a_:

Click to download the PDB-style file with coordinates for d1vp5a_.
(The format of our PDB-style files is described here.)

Timeline for d1vp5a_: