Lineage for d1vp4b_ (1vp4 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589118Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 589119Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 589120Family c.67.1.1: AAT-like [53384] (12 proteins)
  6. 589385Protein Putative aminotransferase TM1131 [117691] (1 species)
  7. 589386Species Thermotoga maritima [TaxId:243274] [117692] (1 PDB entry)
  8. 589388Domain d1vp4b_: 1vp4 B: [113936]
    Structural genomics target
    complexed with edo, fmt, plp, unl

Details for d1vp4b_

PDB Entry: 1vp4 (more details), 1.82 Å

PDB Description: Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 A resolution

SCOP Domain Sequences for d1vp4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vp4b_ c.67.1.1 (B:) Putative aminotransferase TM1131 {Thermotoga maritima}
hhhmvvnlegkiskigqnmkssiireilkfaadkdaisfgggvpdpetfprkelaeiake
iiekeyhytlqysttegdpvlkqqilkllermygitgldednliftvgsqqaldligklf
lddesycvlddpaylgainafrqylanfvvvpleddgmdlnvlerklsefdkngkikqvk
fiyvvsnfhnpagvttslekrkalveiaekydlfiveddpygalryegetvdpifkiggp
ervvllntfskvlapglrigmvagskefirkivqakqsadlcspaithrlaarylerydl
leqlkptielyrrkrtvmlnaleeyfsdipgvkwvksegglfiwltlpegfdtwemfeya
krkkvfyvpgrvfkvydepspsmrlsfclppdekivegikrlrevvleygkekhll

SCOP Domain Coordinates for d1vp4b_:

Click to download the PDB-style file with coordinates for d1vp4b_.
(The format of our PDB-style files is described here.)

Timeline for d1vp4b_: