Lineage for d1vp4a1 (1vp4 A:1-413)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895168Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2895533Protein Putative aminotransferase TM1131 [117691] (1 species)
  7. 2895534Species Thermotoga maritima [TaxId:2336] [117692] (1 PDB entry)
    Uniprot Q9X0L5
  8. 2895535Domain d1vp4a1: 1vp4 A:1-413 [113935]
    Other proteins in same PDB: d1vp4a2, d1vp4b2
    Structural genomics target
    complexed with edo, fmt, plp, unl

Details for d1vp4a1

PDB Entry: 1vp4 (more details), 1.82 Å

PDB Description: Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 A resolution
PDB Compounds: (A:) aminotransferase, putative

SCOPe Domain Sequences for d1vp4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vp4a1 c.67.1.1 (A:1-413) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]}
mvvnlegkiskigqnmkssiireilkfaadkdaisfgggvpdpetfprkelaeiakeiie
keyhytlqysttegdpvlkqqilkllermygitgldednliftvgsqqaldligklfldd
esycvlddpaylgainafrqylanfvvvpleddgmdlnvlerklsefdkngkikqvkfiy
vvsnfhnpagvttslekrkalveiaekydlfiveddpygalryegetvdpifkiggperv
vllntfskvlapglrigmvagskefirkivqakqsadlcspaithrlaarylerydlleq
lkptielyrrkrtvmlnaleeyfsdipgvkwvksegglfiwltlpegfdtwemfeyakrk
kvfyvpgrvfkvydepspsmrlsfclppdekivegikrlrevvleygkekhll

SCOPe Domain Coordinates for d1vp4a1:

Click to download the PDB-style file with coordinates for d1vp4a1.
(The format of our PDB-style files is described here.)

Timeline for d1vp4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vp4a2