SCOPe 2.08: Domain d1vp2b_: 1vp2 B:

Lineage for d1vp2b_ (1vp2 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
   Pfam PF01725

6. Protein Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 [117615] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [117616] (2 PDB entries)
   Uniprot Q9WY06

8. Domain d1vp2b_: 1vp2 B: [113934]
   Structural genomics target
   complexed with so4

Details for d1vp2b_

PDB Entry: 1vp2, 1.78 Å

PDB Description: crystal structure of a putative xanthosine triphosphate pyrophosphatase/ham1 protein homolog (tm0159) from thermotoga maritima at 1.78 a resolution

PDB Compounds: (B:) Putative Xanthosine triphosphate pyrophosphatase/HAM1 protein homolog

SCOPe Domain Sequences for d1vp2b_:

Sequence; same for both SEQRES and ATOM records:

>d1vp2b_ c.51.4.1 (B:) Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 {Thermotoga maritima [TaxId: 2336]}
kltvylattnphkveeikmiapewmeilpspekievvedgetflensvkkavvygkklkh
pvmaddsglviyslggfpgvmsarfmeehsykekmrtilkmlegkdrraafvcsatffdp
ventlisvedrvegrianeirgtggfgydpffipdgydktfgeiphlkekishrskafrk
lfsvlekil

Timeline for d1vp2b_:

• d1vp2b_ first appeared in SCOP 1.71
  
• d1vp2b_ appears in SCOPe 2.07