Lineage for d1vp0w_ (1vp0 W:)

  1. Root: SCOPe 2.07
  2. 2592940Class i: Low resolution protein structures [58117] (25 folds)
  3. 2592941Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2592942Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2592943Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2592944Protein 70S ribosome functional complex [58121] (4 species)
  7. 2592945Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 2593492Domain d1vp0w_: 1vp0 W: [113929]
    Other proteins in same PDB: d1vp072
    50S subunit; the coordinates of 30S subunit in a different PDB entry
    protein/RNA complex
    protein/RNA complex

Details for d1vp0w_

PDB Entry: 1vp0 (more details), 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
PDB Compounds: (W:) general stress protein ctc

SCOPe Domain Sequences for d1vp0w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vp0w_ i.1.1.1 (W:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlp

SCOPe Domain Coordinates for d1vp0w_:

Click to download the PDB-style file with coordinates for d1vp0w_.
(The format of our PDB-style files is described here.)

Timeline for d1vp0w_: