![]() | Class i: Low resolution protein structures [58117] (24 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
![]() | Protein 70S ribosome functional complex [58121] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [58123] (39 PDB entries) |
![]() | Domain d1vozp_: 1voz P: [113898] |
PDB Entry: 1voz (more details)
SCOP Domain Sequences for d1vozp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vozp_ i.1.1.1 (P:) 70S ribosome functional complex {Escherichia coli} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d1vozp_: