SCOPe 2.08: Domain d1vozb_: 1voz B:

Lineage for d1vozb_ (1voz B:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1vozb_: 1voz B: [113884]
   30S subunit; the coordinates of 50S subunit in a different PDB entry
   protein/RNA complex
   protein/RNA complex

Details for d1vozb_

PDB Entry: 1voz, 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.

PDB Compounds: (B:) 30S ribosomal protein S2

SCOPe Domain Sequences for d1vozb_:

Sequence; same for both SEQRES and ATOM records:

>d1vozb_ i.1.1.1 (B:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

Timeline for d1vozb_:

• d1vozb_ first appeared in SCOP 1.71
  
• d1vozb_ appears in SCOPe 2.07