Lineage for d1voyh_ (1voy H:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 753710Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 753711Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 753712Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 753713Protein 70S ribosome functional complex [58121] (3 species)
  7. 753759Species Escherichia coli [TaxId:562] [58123] (34 PDB entries)
  8. 754203Domain d1voyh_: 1voy H: [113864]

Details for d1voyh_

PDB Entry: 1voy (more details)

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
PDB Compounds: (H:) 50S ribosomal protein L6

SCOP Domain Sequences for d1voyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1voyh_ i.1.1.1 (H:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
gkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqkhral
hgltrtlvanavkgvsdgytinlelrgvgfrakltgkalemnigyshpviieppagvtfa
vpeptridvsgidkqlvgqvaanvrkvrkpdayhgkgvrfvgeqialkagkagatgg

SCOP Domain Coordinates for d1voyh_:

Click to download the PDB-style file with coordinates for d1voyh_.
(The format of our PDB-style files is described here.)

Timeline for d1voyh_: