Lineage for d1voy1_ (1voy 1:)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1467792Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1467793Protein 70S ribosome functional complex [58121] (9 species)
  7. 1467866Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1468327Domain d1voy1_: 1voy 1: [113853]
    50S subunit; the coordinates of 30S subunit in a different PDB entry
    protein/RNA complex

Details for d1voy1_

PDB Entry: 1voy (more details), 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
PDB Compounds: (1:) 50S ribosomal protein L31

SCOPe Domain Sequences for d1voy1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1voy1_ i.1.1.1 (1:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mqkdlhpkavpckiiyqgqvvmetmstrpeihvdvwsgvhpfwtgeerfldtegrvdkfn
krfgdsyrrgskk

SCOPe Domain Coordinates for d1voy1_:

Click to download the PDB-style file with coordinates for d1voy1_.
(The format of our PDB-style files is described here.)

Timeline for d1voy1_: