SCOP 1.71: Domain d1voy1_: 1voy 1:

Lineage for d1voy1_ (1voy 1:)

1. Root: SCOP 1.71

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (3 species)

7. Species Escherichia coli [TaxId:562] [58123] (39 PDB entries)

8. Domain d1voy1_: 1voy 1: [113853]

Details for d1voy1_

PDB Entry: 1voy

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.

SCOP Domain Sequences for d1voy1_:

Sequence; same for both SEQRES and ATOM records:

>d1voy1_ i.1.1.1 (1:) 70S ribosome functional complex {Escherichia coli}
mqkdlhpkavpckiiyqgqvvmetmstrpeihvdvwsgvhpfwtgeerfldtegrvdkfn
krfgdsyrrgskk

Timeline for d1voy1_:

• d1voy1_ is new in SCOP 1.71
  
• d1voy1_ appears in SCOP 1.73
  
• d1voy1_ appears in the current release, SCOPe 2.08