Lineage for d1vowy_ (1vow Y:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627097Species Escherichia coli [TaxId:562] [58123] (39 PDB entries)
  8. 627555Domain d1vowy_: 1vow Y: [113831]

Details for d1vowy_

PDB Entry: 1vow (more details)

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.

SCOP Domain Sequences for d1vowy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vowy_ i.1.1.1 (Y:) 70S ribosome functional complex {Escherichia coli}
kpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkaela
rkgeq

SCOP Domain Coordinates for d1vowy_:

Click to download the PDB-style file with coordinates for d1vowy_.
(The format of our PDB-style files is described here.)

Timeline for d1vowy_: