| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
| Protein 70S ribosome functional complex [58121] (4 species) |
| Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
| Domain d1vow5_: 1vow 5: [113807] Other proteins in same PDB: d1vow72 50S subunit; the coordinates of 30S subunit in a different PDB entry protein/RNA complex protein/RNA complex |
PDB Entry: 1vow (more details), 11.5 Å
SCOPe Domain Sequences for d1vow5_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vow5_ i.1.1.1 (5:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr
Timeline for d1vow5_:
View in 3DDomains from other chains: (mouse over for more information) d1vow1_, d1vow2_, d1vow3_, d1vow4_, d1vow6_, d1vow71, d1vow72, d1vowd_, d1vowe_, d1vowf_, d1vowg_, d1vowh_, d1vowi_, d1vowj_, d1vowk_, d1vowl_, d1vowm_, d1vown_, d1vowo_, d1vowp_, d1vowq_, d1vowr_, d1vows_, d1vowt_, d1vowu_, d1vowv_, d1voww_, d1vowx_, d1vowy_, d1vowz_ |