Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
Domain d1vovm_: 1vov M: [113795] 30S subunit; the coordinates of 50S subunit in a different PDB entry protein/RNA complex |
PDB Entry: 1vov (more details), 11.5 Å
SCOPe Domain Sequences for d1vovm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vovm_ i.1.1.1 (M:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk kaprk
Timeline for d1vovm_: