Lineage for d1vouy_ (1vou Y:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896398Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 896857Domain d1vouy_: 1vou Y: [113781]
    50S subunit; the coordinates of 30S subunit in a different PDB entry

Details for d1vouy_

PDB Entry: 1vou (more details), 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
PDB Compounds: (Y:) 50S ribosomal protein L29

SCOP Domain Sequences for d1vouy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vouy_ i.1.1.1 (Y:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
kpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkaela
rkgeq

SCOP Domain Coordinates for d1vouy_:

Click to download the PDB-style file with coordinates for d1vouy_.
(The format of our PDB-style files is described here.)

Timeline for d1vouy_: