| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
| Protein 70S ribosome functional complex [58121] (4 species) |
| Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
| Domain d1vouw_: 1vou W: [113779] Other proteins in same PDB: d1vou72 50S subunit; the coordinates of 30S subunit in a different PDB entry protein/RNA complex protein/RNA complex |
PDB Entry: 1vou (more details), 11.5 Å
SCOPe Domain Sequences for d1vouw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vouw_ i.1.1.1 (W:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlp
Timeline for d1vouw_:
View in 3DDomains from other chains: (mouse over for more information) d1vou1_, d1vou2_, d1vou3_, d1vou4_, d1vou5_, d1vou6_, d1vou71, d1vou72, d1voud_, d1voue_, d1vouf_, d1voug_, d1vouh_, d1voui_, d1vouj_, d1vouk_, d1voul_, d1voum_, d1voun_, d1vouo_, d1voup_, d1vouq_, d1vour_, d1vous_, d1vout_, d1vouu_, d1vouv_, d1voux_, d1vouy_, d1vouz_ |