Lineage for d1vou4_ (1vou 4:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3042559Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 3042963Domain d1vou4_: 1vou 4: [113756]
    Other proteins in same PDB: d1vou72
    50S subunit; the coordinates of 30S subunit in a different PDB entry
    protein/RNA complex
    protein/RNA complex

Details for d1vou4_

PDB Entry: 1vou (more details), 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
PDB Compounds: (4:) 50S ribosomal protein L34

SCOPe Domain Sequences for d1vou4_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vou4_ i.1.1.1 (4:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

SCOPe Domain Coordinates for d1vou4_:

Click to download the PDB-style file with coordinates for d1vou4_.
(The format of our PDB-style files is described here.)

Timeline for d1vou4_: