Lineage for d1vost_ (1vos T:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 753710Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 753711Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 753712Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 753713Protein 70S ribosome functional complex [58121] (3 species)
  7. 753759Species Escherichia coli [TaxId:562] [58123] (34 PDB entries)
  8. 753902Domain d1vost_: 1vos T: [113752]
    30S subunit; the coordinates of 50S subunit in a different PDB entry

Details for d1vost_

PDB Entry: 1vos (more details)

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
PDB Compounds: (T:) 30S ribosomal protein S20

SCOP Domain Sequences for d1vost_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vost_ i.1.1.1 (T:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1vost_:

Click to download the PDB-style file with coordinates for d1vost_.
(The format of our PDB-style files is described here.)

Timeline for d1vost_: