Lineage for d1vort_ (1vor T:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1710427Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1710851Domain d1vort_: 1vor T: [113726]
    50S subunit; the coordinates of 30S subunit in a different PDB entry
    protein/RNA complex

Details for d1vort_

PDB Entry: 1vor (more details), 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
PDB Compounds: (T:) 50S ribosomal protein L22

SCOPe Domain Sequences for d1vort_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vort_ i.1.1.1 (T:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
eqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsa
sepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshi
tiivaekgnk

SCOPe Domain Coordinates for d1vort_:

Click to download the PDB-style file with coordinates for d1vort_.
(The format of our PDB-style files is described here.)

Timeline for d1vort_: