Lineage for d1vorj_ (1vor J:)

  1. Root: SCOPe 2.08
  2. Class i: Low resolution protein structures [58117] (25 folds)
  3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. Protein 70S ribosome functional complex [58121] (4 species)
  7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. Domain d1vorj_: 1vor J: [113716]
    Other proteins in same PDB: d1vor72
    50S subunit; the coordinates of 30S subunit in a different PDB entry
    protein/RNA complex
    protein/RNA complex

Details for d1vorj_

PDB Entry: 1vor (more details), 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
PDB Compounds: (J:) 50S ribosomal protein L11

SCOPe Domain Sequences for d1vorj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vorj_ i.1.1.1 (J:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy
adrsftfitktppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsv
eaaantvagtarsmgvtveggpn

SCOPe Domain Coordinates for d1vorj_ are not available.

Timeline for d1vorj_: