Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
Domain d1vori_: 1vor I: [113715] 50S subunit; the coordinates of 30S subunit in a different PDB entry protein/RNA complex |
PDB Entry: 1vor (more details), 11.5 Å
SCOPe Domain Sequences for d1vori_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vori_ i.1.1.1 (I:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} mqvillepsrlgktgevvsvkdgyarnwlipqglavsatrtnmktleaqlrs
Timeline for d1vori_:
View in 3D Domains from other chains: (mouse over for more information) d1vor1_, d1vor2_, d1vor3_, d1vor4_, d1vor5_, d1vor6_, d1vor7_, d1vord_, d1vore_, d1vorf_, d1vorg_, d1vorh_, d1vorj_, d1vork_, d1vorl_, d1vorm_, d1vorn_, d1voro_, d1vorp_, d1vorq_, d1vorr_, d1vors_, d1vort_, d1voru_, d1vorv_, d1vorw_, d1vorx_, d1vory_, d1vorz_ |