SCOP 1.73: Domain d1vor3_: 1vor 3:

Lineage for d1vor3_ (1vor 3:)

1. Root: SCOP 1.73

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (3 species)

7. Species Escherichia coli [TaxId:562] [58123] (34 PDB entries)

8. Domain d1vor3_: 1vor 3: [113705]

Details for d1vor3_

PDB Entry: 1vor

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.

PDB Compounds: (3:) 50S ribosomal protein L33

SCOP Domain Sequences for d1vor3_:

Sequence; same for both SEQRES and ATOM records:

>d1vor3_ i.1.1.1 (3:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk

Timeline for d1vor3_:

• d1vor3_ first appeared in SCOP 1.71
  
• d1vor3_ appears in SCOP 1.75
  
• d1vor3_ appears in the current release, SCOPe 2.08