Lineage for d1voqf_ (1voq F:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1710427Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. Domain d1voqf_: 1voq F: [113688]
    30S subunit; the coordinates of 50S subunit in a different PDB entry
    protein/RNA complex

Details for d1voqf_

PDB Entry: 1voq (more details), 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1voqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1voqf_ i.1.1.1 (F:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d1voqf_:

Click to download the PDB-style file with coordinates for d1voqf_.
(The format of our PDB-style files is described here.)

Timeline for d1voqf_: