![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
![]() | Protein 70S ribosome functional complex [58121] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
![]() | Domain d1voqe_: 1voq E: [113687] 30S subunit; the coordinates of 50S subunit in a different PDB entry protein/RNA complex protein/RNA complex |
PDB Entry: 1voq (more details), 11.5 Å
SCOPe Domain Sequences for d1voqe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1voqe_ i.1.1.1 (E:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg srnpiniayatmealrqlrtkadverlrkg
Timeline for d1voqe_: