Lineage for d1vmkc_ (1vmk C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2887952Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)
  7. 2888211Species Thermotoga maritima [TaxId:2336] [117654] (1 PDB entry)
    Uniprot Q9X1T2
  8. 2888214Domain d1vmkc_: 1vmk C: [113682]
    Structural genomics target
    complexed with gun, mg

Details for d1vmkc_

PDB Entry: 1vmk (more details), 2.01 Å

PDB Description: Crystal structure of Purine nucleoside phosphorylase (TM1596) from Thermotoga maritima at 2.01 A resolution
PDB Compounds: (C:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1vmkc_:

Sequence, based on SEQRES records: (download)

>d1vmkc_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Thermotoga maritima [TaxId: 2336]}
mmkkieeartfisertnlspdiliilgsgfgpfiekvedpviidykdiphfpqptveghs
gklvfgrisdkpvmimagrfhlyeghdpatvafpvylakyvgvkgvvvtnaagainpefk
pgeiilvrdiinfmfrnplrgpndekigprfpdmssvvdpewarkiqerlslkegvyigv
lgpsyetpaeirvfeklgadlvgmstvpeviaakhcglkvvvfscvtnmaagithgrlsh
eevvrttkmaqgkiekalttavevf

Sequence, based on observed residues (ATOM records): (download)

>d1vmkc_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Thermotoga maritima [TaxId: 2336]}
mmkkieeartfisertnlspdiliilgfiekvedpviidykdiphfpgklvfgrisdkpv
mimagrfhlyeghdpatvafpvylakyvgvkgvvvtnaagainpefkpgeiilvrdiinf
mfrnplrgpndekigprfpdmssvvdpewarkiqerlslkegvyigvlgpsyetpaeirv
feklgadlvgmstvpeviaakhcglkvvvfscvtnmaagitttkmaqgkiekalttavev
f

SCOPe Domain Coordinates for d1vmkc_:

Click to download the PDB-style file with coordinates for d1vmkc_.
(The format of our PDB-style files is described here.)

Timeline for d1vmkc_: