Lineage for d1vmja_ (1vmj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009385Fold d.273: YjbQ-like [111037] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets
  4. 3009386Superfamily d.273.1: YjbQ-like [111038] (2 families) (S)
  5. 3009387Family d.273.1.1: YjbQ-like [111039] (5 proteins)
    Pfam PF01894
  6. 3009407Protein Hypothetical protein TM0723 [118034] (1 species)
  7. 3009408Species Thermotoga maritima [TaxId:2336] [118035] (1 PDB entry)
    Uniprot Q9WZI2
  8. 3009409Domain d1vmja_: 1vmj A: [113679]
    Structural genomics target
    complexed with na, so4

Details for d1vmja_

PDB Entry: 1vmj (more details), 1.52 Å

PDB Description: crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution
PDB Compounds: (A:) hypothetical protein TM0723

SCOPe Domain Sequences for d1vmja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vmja_ d.273.1.1 (A:) Hypothetical protein TM0723 {Thermotoga maritima [TaxId: 2336]}
mksyrkelwfhtkrrrefinitplleecvresgikeglllcnamhitasvfinddepglh
hdfevwleklapekpysqykhndtgednadahlkrtimgrevviaitdrkmdlgpweqvf
ygefdgmrpkrvlvkiige

SCOPe Domain Coordinates for d1vmja_:

Click to download the PDB-style file with coordinates for d1vmja_.
(The format of our PDB-style files is described here.)

Timeline for d1vmja_: