Lineage for d1vmia_ (1vmi A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 591543Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 591544Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) (S)
    the constituent families form similar dimers
  5. 591670Family c.77.1.5: Phosphotransacetylase [102663] (2 proteins)
    Pfam 01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families
  6. 591671Protein Ethanolamine utilization protein EutD [117727] (1 species)
  7. 591672Species Escherichia coli [TaxId:562] [117728] (1 PDB entry)
  8. 591673Domain d1vmia_: 1vmi A: [113678]
    Structural genomics target
    complexed with gol

Details for d1vmia_

PDB Entry: 1vmi (more details), 2.32 Å

PDB Description: Crystal structure of Putative phosphate acetyltransferase (np_416953.1) from Escherichia coli k12 at 2.32 A resolution

SCOP Domain Sequences for d1vmia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vmia_ c.77.1.5 (A:) Ethanolamine utilization protein EutD {Escherichia coli}
tdpalraiiercrelalraparvvfpdaldqrvlkaaqylhqqglatpilvanpfelrqf
alshgvamdglqvidphgnlamreefahrwlaragektppdalekltdplmfaaamvsag
kadvciagnlsstanvlraglriiglqpgcktlssiflmlpqysgpalgfadcsvvpqpt
aaqladialasaetwraitgeeprvamlsfssngsarhpcvanvqqateivrerapklvv
dgelqfdaafvpevaaqkapasplqgkanvmvfpsleagnigykiaqrlggyravgpliq
glaapmhdlsrgcsvqeiielalvaavpr

SCOP Domain Coordinates for d1vmia_:

Click to download the PDB-style file with coordinates for d1vmia_.
(The format of our PDB-style files is described here.)

Timeline for d1vmia_: