SCOP 1.71: Domain d1vmga_: 1vmg A:

Lineage for d1vmga_ (1vmg A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (2 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.2: MazG-like [116993] (1 protein)
   Pfam 03819

6. Protein Hypothetical protein SSo12199 (SSo3215) [116994] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [116995] (1 PDB entry)

8. Domain d1vmga_: 1vmg A: [113676]
   Structural genomics target
   complexed with li, unl

Details for d1vmga_

PDB Entry: 1vmg, 1.46 Å

PDB Description: Crystal structure of MazG nucleotide pyrophosphohydrolase (13816655) from Sulfolobus solfataricus at 1.46 A resolution

SCOP Domain Sequences for d1vmga_:

Sequence; same for both SEQRES and ATOM records:

>d1vmga_ a.204.1.2 (A:) Hypothetical protein SSo12199 (SSo3215) {Thermotoga maritima}
mdlelkelqskmkemyfekdsqrgiyatftwlveevgelaeallsnnldsiqeeladvia
wtvsianlegidieealkkkykl

Timeline for d1vmga_:

• d1vmga_ is new in SCOP 1.71
  
• d1vmga_ appears in SCOP 1.73
  
• d1vmga_ appears in the current release, SCOPe 2.08