Class a: All alpha proteins [46456] (290 folds) |
Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
Family a.204.1.2: MazG-like [116993] (4 proteins) Pfam PF03819 |
Protein Hypothetical protein SSo12199 (SSo3215) [116994] (1 species) |
Species Sulfolobus solfataricus [TaxId:2287] [116995] (1 PDB entry) Uniprot Q97U11 |
Domain d1vmga_: 1vmg A: [113676] Structural genomics target complexed with li, unl |
PDB Entry: 1vmg (more details), 1.46 Å
SCOPe Domain Sequences for d1vmga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vmga_ a.204.1.2 (A:) Hypothetical protein SSo12199 (SSo3215) {Sulfolobus solfataricus [TaxId: 2287]} mdlelkelqskmkemyfekdsqrgiyatftwlveevgelaeallsnnldsiqeeladvia wtvsianlegidieealkkkykl
Timeline for d1vmga_: