Lineage for d1vmga_ (1vmg A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014645Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 2014646Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 2014659Family a.204.1.2: MazG-like [116993] (4 protein domains)
    Pfam PF03819
  6. 2014660Protein Hypothetical protein SSo12199 (SSo3215) [116994] (1 species)
  7. 2014661Species Sulfolobus solfataricus [TaxId:2287] [116995] (1 PDB entry)
    Uniprot Q97U11
  8. 2014662Domain d1vmga_: 1vmg A: [113676]
    Structural genomics target
    complexed with li, unl

Details for d1vmga_

PDB Entry: 1vmg (more details), 1.46 Å

PDB Description: Crystal structure of MazG nucleotide pyrophosphohydrolase (13816655) from Sulfolobus solfataricus at 1.46 A resolution
PDB Compounds: (A:) Hypothetical protein SSO3215

SCOPe Domain Sequences for d1vmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vmga_ a.204.1.2 (A:) Hypothetical protein SSo12199 (SSo3215) {Sulfolobus solfataricus [TaxId: 2287]}
mdlelkelqskmkemyfekdsqrgiyatftwlveevgelaeallsnnldsiqeeladvia
wtvsianlegidieealkkkykl

SCOPe Domain Coordinates for d1vmga_:

Click to download the PDB-style file with coordinates for d1vmga_.
(The format of our PDB-style files is described here.)

Timeline for d1vmga_: