SCOPe 2.08: Domain d1vmfc1: 1vmf C:1-133

Lineage for d1vmfc1 (1vmf C:1-133)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.273: YjbQ-like [111037] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets

4. Superfamily d.273.1: YjbQ-like [111038] (2 families)

5. Family d.273.1.1: YjbQ-like [111039] (5 proteins)
   Pfam PF01894

6. Protein Hypothetical protein BH3498 [118032] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [118033] (1 PDB entry)
   Uniprot Q9K772

8. Domain d1vmfc1: 1vmf C:1-133 [113675]
   Other proteins in same PDB: d1vmfa2, d1vmfb2, d1vmfc2
   Structural genomics target
   complexed with act, edo, epe, na

Details for d1vmfc1

PDB Entry: 1vmf, 1.46 Å

PDB Description: crystal structure of a ybjq-like fold protein of unknown function (bh3498) from bacillus halodurans at 1.46 a resolution

PDB Compounds: (C:) hypothetical protein

SCOPe Domain Sequences for d1vmfc1:

Sequence; same for both SEQRES and ATOM records:

>d1vmfc1 d.273.1.1 (C:1-133) Hypothetical protein BH3498 {Bacillus halodurans [TaxId: 86665]}
mktfhlttqsrdemvditsqietwiretgvtngvaivsslhttagitvnenadpdvkrdm
imrldevypwhhendrhmegntaahlktstvghaqtliisegrlvlgtwqgvyfcefdgp
rtnrkfvvklltd

Timeline for d1vmfc1:

• d1vmfc1 first appeared in SCOP 1.71, called d1vmfc_
  
• d1vmfc1 appears in SCOPe 2.07