![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.273: YjbQ-like [111037] (1 superfamily) beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets |
![]() | Superfamily d.273.1: YjbQ-like [111038] (2 families) ![]() |
![]() | Family d.273.1.1: YjbQ-like [111039] (5 proteins) Pfam PF01894 |
![]() | Protein Hypothetical protein BH3498 [118032] (1 species) |
![]() | Species Bacillus halodurans [TaxId:86665] [118033] (1 PDB entry) Uniprot Q9K772 |
![]() | Domain d1vmfc1: 1vmf C:1-133 [113675] Other proteins in same PDB: d1vmfa2, d1vmfb2, d1vmfc2 Structural genomics target complexed with act, edo, epe, na |
PDB Entry: 1vmf (more details), 1.46 Å
SCOPe Domain Sequences for d1vmfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vmfc1 d.273.1.1 (C:1-133) Hypothetical protein BH3498 {Bacillus halodurans [TaxId: 86665]} mktfhlttqsrdemvditsqietwiretgvtngvaivsslhttagitvnenadpdvkrdm imrldevypwhhendrhmegntaahlktstvghaqtliisegrlvlgtwqgvyfcefdgp rtnrkfvvklltd
Timeline for d1vmfc1:
![]() Domains from other chains: (mouse over for more information) d1vmfa1, d1vmfa2, d1vmfb1, d1vmfb2 |