Lineage for d1vmfb1 (1vmf B:1-133)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615221Fold d.273: YjbQ-like [111037] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets
  4. 2615222Superfamily d.273.1: YjbQ-like [111038] (2 families) (S)
  5. 2615223Family d.273.1.1: YjbQ-like [111039] (5 proteins)
    Pfam PF01894
  6. 2615230Protein Hypothetical protein BH3498 [118032] (1 species)
  7. 2615231Species Bacillus halodurans [TaxId:86665] [118033] (1 PDB entry)
    Uniprot Q9K772
  8. 2615233Domain d1vmfb1: 1vmf B:1-133 [113674]
    Other proteins in same PDB: d1vmfa2, d1vmfb2, d1vmfc2
    Structural genomics target
    complexed with act, edo, epe, na

Details for d1vmfb1

PDB Entry: 1vmf (more details), 1.46 Å

PDB Description: crystal structure of a ybjq-like fold protein of unknown function (bh3498) from bacillus halodurans at 1.46 a resolution
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1vmfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vmfb1 d.273.1.1 (B:1-133) Hypothetical protein BH3498 {Bacillus halodurans [TaxId: 86665]}
mktfhlttqsrdemvditsqietwiretgvtngvaivsslhttagitvnenadpdvkrdm
imrldevypwhhendrhmegntaahlktstvghaqtliisegrlvlgtwqgvyfcefdgp
rtnrkfvvklltd

SCOPe Domain Coordinates for d1vmfb1:

Click to download the PDB-style file with coordinates for d1vmfb1.
(The format of our PDB-style files is described here.)

Timeline for d1vmfb1: