![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) ![]() |
![]() | Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
![]() | Protein Ribosomal protein S6 [54997] (4 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [117978] (1 PDB entry) Uniprot Q9WZ72 |
![]() | Domain d1vmba_: 1vmb A: [113672] Structural genomics target complexed with edo |
PDB Entry: 1vmb (more details), 1.7 Å
SCOPe Domain Sequences for d1vmba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vmba_ d.58.14.1 (A:) Ribosomal protein S6 {Thermotoga maritima [TaxId: 2336]} keriyesmfiiapnvpeeerenlvervkkiieervkgkidkvermgmrkfayeikkfneg dytviyfrcdgqnlqelenfyrvtpeiirwqtfrrfdlekkerkaqr
Timeline for d1vmba_: