Lineage for d1vm8a_ (1vm8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133197Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 protein domains)
  6. 2133233Protein UDP-N-acetylglucosamine pyrophosphorylase [75280] (3 species)
  7. 2133244Species Mouse (Mus musculus), AGX2 [TaxId:10090] [117698] (1 PDB entry)
    Uniprot Q91YN5
  8. 2133245Domain d1vm8a_: 1vm8 A: [113670]
    Structural genomics target
    complexed with cl, edo

Details for d1vm8a_

PDB Entry: 1vm8 (more details), 2.5 Å

PDB Description: Crystal structure of UDP-N-acetylglucosamine pyrophosphorylase (Agx2) from Mus musculus at 2.50 A resolution
PDB Compounds: (A:) udp-n-acetylglucosamine pyrophosphorylase

SCOPe Domain Sequences for d1vm8a_:

Sequence, based on SEQRES records: (download)

>d1vm8a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Mouse (Mus musculus), AGX2 [TaxId: 10090]}
nvndlkqrlsqagqehllqfwnelseaqqmelymelqamnfeelnsffrkaigefdrssh
qekvdarmepvprqvlgsatrdqeqlqaweseglsqisqnkvavlllaggqgtrlgvsyp
kgmydvglpshktlfqiqaerilklqqlaekhhgnkctipwyimtsgrtmestkefftkh
kffglkkenvvffqqgmlpamsfdgkiileeknkvsmapdgngglyralaaqnivedmeq
rgicsihvycvdnilvkvadprfigfciqkgadcgakvvektnptepvgvvcrvdgvyqv
veyseislataqrrssdgrllfnagnianhfftvpflkdvvnvyepqlqhhvaqkkipyv
dsqgyfikpdkpngikmekfvfdifqfakkfvvyevlredefsplknadsqngkdnptta
rhalmslhhcwvlnagghfidengsrlpaiprsatngkseaitadvnhnlkdandvpiqc
eisplisyageglegyvadkefhapliidengvhel

Sequence, based on observed residues (ATOM records): (download)

>d1vm8a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Mouse (Mus musculus), AGX2 [TaxId: 10090]}
nvndlkqrlsqagqehllqfwnelseaqqmelymelqamnfeelnsffrkaigefdrssh
qekvdarmepvprqvlgsatrdqeqlqaweseglsqisqnkvavlllaggqgtrlgvsyp
kgmydvglpshktlfqiqaerilklqqlaekhhgnkctipwyimtsgrtmestkefftkh
kffglkkenvvffqqgmlpamsfdgkiileeknkvsmapdgngglyralaaqnivedmeq
rgicsihvycvdnilvkvadprfigfciqkgadcgakvvektnptepvgvvcrvdgvyqv
veyseislataqrrssdgrllfnagnianhfftvpflkdvvnvyepqlqhhvaqkkipyv
dsqgyfikpdkpngikmekfvfdifqfakkfvvyevlredefsplknadsqgkdnpttar
halmslhhcwvlnagghfidengsrlpaipvpiqceisplisyageglegyvadkefhap
liidengvhel

SCOPe Domain Coordinates for d1vm8a_:

Click to download the PDB-style file with coordinates for d1vm8a_.
(The format of our PDB-style files is described here.)

Timeline for d1vm8a_: