![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Putative acetyltransferase PF0028 [118072] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [118073] (1 PDB entry) Uniprot Q8U4Q2 |
![]() | Domain d1vkcb_: 1vkc B: [113664] Structural genomics target complexed with iod |
PDB Entry: 1vkc (more details), 1.89 Å
SCOPe Domain Sequences for d1vkcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vkcb_ d.108.1.1 (B:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} eytivdgeeyieeikkldreisysfvrfpisyeeyeerheelfesllsqgehkffvalne rsellghvwicitldtvdyvkiayiydievvkwarglgigsallrkaeewakergakkiv lrveidnpavkwyeergykaralimekpi
Timeline for d1vkcb_: