Lineage for d1vkcb_ (1vkc B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533520Protein Putative acetyltransferase PF0028 [118072] (1 species)
  7. 2533521Species Pyrococcus furiosus [TaxId:2261] [118073] (1 PDB entry)
    Uniprot Q8U4Q2
  8. 2533523Domain d1vkcb_: 1vkc B: [113664]
    Structural genomics target
    complexed with iod

Details for d1vkcb_

PDB Entry: 1vkc (more details), 1.89 Å

PDB Description: putative acetyl transferase from pyrococcus furiosus
PDB Compounds: (B:) putative acetyl transferase

SCOPe Domain Sequences for d1vkcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkcb_ d.108.1.1 (B:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]}
eytivdgeeyieeikkldreisysfvrfpisyeeyeerheelfesllsqgehkffvalne
rsellghvwicitldtvdyvkiayiydievvkwarglgigsallrkaeewakergakkiv
lrveidnpavkwyeergykaralimekpi

SCOPe Domain Coordinates for d1vkcb_:

Click to download the PDB-style file with coordinates for d1vkcb_.
(The format of our PDB-style files is described here.)

Timeline for d1vkcb_: