![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.256: Ta1353-like [103164] (1 superfamily) core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423; |
![]() | Superfamily d.256.1: Ta1353-like [103165] (2 families) ![]() |
![]() | Family d.256.1.1: Ta1353-like [103166] (2 proteins) Pfam PF04008 |
![]() | Protein Hypothetical protein TT1634 (TTHA1091) [118062] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [118063] (1 PDB entry) Uniprot Q5SJC3 |
![]() | Domain d1vggf_: 1vgg F: [113652] Structural genomics target |
PDB Entry: 1vgg (more details), 1.75 Å
SCOPe Domain Sequences for d1vggf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vggf_ d.256.1.1 (F:) Hypothetical protein TT1634 (TTHA1091) {Thermus thermophilus [TaxId: 274]} melklipiekpenlnvilgqahfiktvedlhealvtavpgirfglafseasgkrlvrrsg tdealvelavknllnlacghvflivlgegfypinvlhavkacpevvriyaatanplkvvv aeegeqrailgvmdgftplgvedeaevawrkdllrrlgykl
Timeline for d1vggf_: