SCOP 1.71: Domain d1vggf_: 1vgg F:

Lineage for d1vggf_ (1vgg F:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.256: Ta1353-like [103164] (1 superfamily)
   core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423;

4. Superfamily d.256.1: Ta1353-like [103165] (1 family)

5. Family d.256.1.1: Ta1353-like [103166] (2 proteins)
   Pfam 04008

6. Protein Hypothetical protein TT1634 (TTHA1091) [118062] (1 species)

7. Species Thermus thermophilus [TaxId:274] [118063] (1 PDB entry)

8. Domain d1vggf_: 1vgg F: [113652]
   Structural genomics target

Details for d1vggf_

PDB Entry: 1vgg, 1.75 Å

PDB Description: Crystal Structure of the Conserved Hypothetical Protein TTHA1091 from Thermus Thermophilus HB8

SCOP Domain Sequences for d1vggf_:

Sequence; same for both SEQRES and ATOM records:

>d1vggf_ d.256.1.1 (F:) Hypothetical protein TT1634 (TTHA1091) {Thermus thermophilus}
melklipiekpenlnvilgqahfiktvedlhealvtavpgirfglafseasgkrlvrrsg
tdealvelavknllnlacghvflivlgegfypinvlhavkacpevvriyaatanplkvvv
aeegeqrailgvmdgftplgvedeaevawrkdllrrlgykl

Timeline for d1vggf_:

• d1vggf_ is new in SCOP 1.71
  
• d1vggf_ appears in SCOP 1.73
  
• d1vggf_ appears in the current release, SCOPe 2.08