Lineage for d1vggd_ (1vgg D:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740990Fold d.256: Ta1353-like [103164] (1 superfamily)
    core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423;
  4. 740991Superfamily d.256.1: Ta1353-like [103165] (1 family) (S)
  5. 740992Family d.256.1.1: Ta1353-like [103166] (2 proteins)
    Pfam PF04008
  6. 740996Protein Hypothetical protein TT1634 (TTHA1091) [118062] (1 species)
  7. 740997Species Thermus thermophilus [TaxId:274] [118063] (1 PDB entry)
  8. 741001Domain d1vggd_: 1vgg D: [113650]

Details for d1vggd_

PDB Entry: 1vgg (more details), 1.75 Å

PDB Description: Crystal Structure of the Conserved Hypothetical Protein TTHA1091 from Thermus Thermophilus HB8
PDB Compounds: (D:) Conserved Hypothetical Protein TT1634

SCOP Domain Sequences for d1vggd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vggd_ d.256.1.1 (D:) Hypothetical protein TT1634 (TTHA1091) {Thermus thermophilus [TaxId: 274]}
melklipiekpenlnvilgqahfiktvedlhealvtavpgirfglafseasgkrlvrrsg
tdealvelavknllnlacghvflivlgegfypinvlhavkacpevvriyaatanplkvvv
aeegeqrailgvmdgftplgvedeaevawrkdllrrlgykl

SCOP Domain Coordinates for d1vggd_:

Click to download the PDB-style file with coordinates for d1vggd_.
(The format of our PDB-style files is described here.)

Timeline for d1vggd_: