Lineage for d1vgga_ (1vgg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008980Fold d.256: Ta1353-like [103164] (1 superfamily)
    core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423;
  4. 3008981Superfamily d.256.1: Ta1353-like [103165] (2 families) (S)
  5. 3008982Family d.256.1.1: Ta1353-like [103166] (2 proteins)
    Pfam PF04008
  6. 3008986Protein Hypothetical protein TT1634 (TTHA1091) [118062] (1 species)
  7. 3008987Species Thermus thermophilus [TaxId:274] [118063] (1 PDB entry)
    Uniprot Q5SJC3
  8. 3008988Domain d1vgga_: 1vgg A: [113647]
    Structural genomics target

Details for d1vgga_

PDB Entry: 1vgg (more details), 1.75 Å

PDB Description: Crystal Structure of the Conserved Hypothetical Protein TTHA1091 from Thermus Thermophilus HB8
PDB Compounds: (A:) Conserved Hypothetical Protein TT1634 (TTHA1091)

SCOPe Domain Sequences for d1vgga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgga_ d.256.1.1 (A:) Hypothetical protein TT1634 (TTHA1091) {Thermus thermophilus [TaxId: 274]}
melklipiekpenlnvilgqahfiktvedlhealvtavpgirfglafseasgkrlvrrsg
tdealvelavknllnlacghvflivlgegfypinvlhavkacpevvriyaatanplkvvv
aeegeqrailgvmdgftplgvedeaevawrkdllrrlgykl

SCOPe Domain Coordinates for d1vgga_:

Click to download the PDB-style file with coordinates for d1vgga_.
(The format of our PDB-style files is described here.)

Timeline for d1vgga_: