Lineage for d1vgfa_ (1vgf A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608816Fold d.103: CytB endotoxin-like [55675] (1 superfamily)
    core: beta-alpha(2)-beta-alpha(2)-beta(4); 3 layers: a/b/a
  4. 608817Superfamily d.103.1: CytB endotoxin-like [55676] (1 family) (S)
  5. 608818Family d.103.1.1: CytB endotoxin-like [55677] (2 proteins)
    Pfam 01338
  6. 608822Protein Volvatoxin A2 [111090] (1 species)
  7. 608823Species Volvariella volvacea, different isoforms [TaxId:36659] [111091] (4 PDB entries)
  8. 608828Domain d1vgfa_: 1vgf A: [113645]

Details for d1vgfa_

PDB Entry: 1vgf (more details), 2.6 Å

PDB Description: volvatoxin A2 (diamond crystal form)

SCOP Domain Sequences for d1vgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgfa_ d.103.1.1 (A:) Volvatoxin A2 {Volvariella volvacea, different isoforms}
nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
nvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknfavqi
dalelvvkkgfkap

SCOP Domain Coordinates for d1vgfa_:

Click to download the PDB-style file with coordinates for d1vgfa_.
(The format of our PDB-style files is described here.)

Timeline for d1vgfa_: