Lineage for d1vgac_ (1vga C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570218Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 570219Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 570220Protein Triosephosphate isomerase [51353] (17 species)
  7. 570305Species Plasmodium falciparum [51359] (9 PDB entries)
  8. 570311Domain d1vgac_: 1vga C: [113643]

Details for d1vgac_

PDB Entry: 1vga (more details), 1.8 Å

PDB Description: structures of unligated and inhibitor complexes of w168f mutant of triosephosphate isomerase from plasmodium falciparum

SCOP Domain Sequences for d1vgac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgac_ c.1.1.1 (C:) Triosephosphate isomerase {Plasmodium falciparum}
rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplfaigtgktatpeqaq
lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
iiksam

SCOP Domain Coordinates for d1vgac_:

Click to download the PDB-style file with coordinates for d1vgac_.
(The format of our PDB-style files is described here.)

Timeline for d1vgac_: