Lineage for d1vgab_ (1vga B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 968087Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 968088Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 968089Protein Triosephosphate isomerase [51353] (20 species)
  7. 968160Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51359] (20 PDB entries)
    Uniprot Q07412
  8. 968172Domain d1vgab_: 1vga B: [113642]
    mutant

Details for d1vgab_

PDB Entry: 1vga (more details), 1.8 Å

PDB Description: structures of unligated and inhibitor complexes of w168f mutant of triosephosphate isomerase from plasmodium falciparum
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d1vgab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgab_ c.1.1.1 (B:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplfaigtgktatpeqaq
lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
iiksam

SCOPe Domain Coordinates for d1vgab_:

Click to download the PDB-style file with coordinates for d1vgab_.
(The format of our PDB-style files is described here.)

Timeline for d1vgab_: