SCOP 1.73: Domain d1vg5a_: 1vg5 A:

Lineage for d1vg5a_ (1vg5 A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (4 families)

5. Family a.5.2.1: UBA domain [46935] (22 proteins)

6. Protein Rhomboid family protein At3g58460 [116828] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116829] (1 PDB entry)

8. Domain d1vg5a_: 1vg5 A: [113640]

Details for d1vg5a_

PDB Entry: 1vg5

PDB Description: solution structure of rsgi ruh-014, a uba domain from arabidopsis cdna

PDB Compounds: (A:) rhomboid family protein

SCOP Domain Sequences for d1vg5a_:

Sequence; same for both SEQRES and ATOM records:

>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gssgssgsrqapianaavlpqsqgrvaaseeqiqklvamgfdrtqvevalaaadddltva
veilmsqsgpssg

Timeline for d1vg5a_:

• d1vg5a_ first appeared in SCOP 1.71
  
• d1vg5a_ appears in SCOP 1.75
  
• d1vg5a_ appears in the current release, SCOPe 2.08, called d1vg5a1